![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) automatically mapped to Pfam PF00297 |
![]() | Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
![]() | Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries) Uniprot P20279 |
![]() | Domain d1vq9b1: 1vq9 B:1-337 [120218] Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1 automatically matched to d1jj2b_ protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr |
PDB Entry: 1vq9 (more details), 2.4 Å
SCOPe Domain Sequences for d1vq9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq9b1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]} pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
Timeline for d1vq9b1:
![]() Domains from other chains: (mouse over for more information) d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1 |