SCOPe 2.08: Domain d1vq711: 1vq7 1:1-56

Lineage for d1vq711 (1vq7 1:1-56)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
   automatically mapped to Pfam PF01907

6. Protein Ribosomal protein L37e [57834] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
   Uniprot P32410

8. Domain d1vq711: 1vq7 1:1-56 [120156]
   Other proteins in same PDB: d1vq721, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
   automatically matched to d1ffkx_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq711

PDB Entry: 1vq7, 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d1vq711:

Sequence; same for both SEQRES and ATOM records:

>d1vq711 g.41.8.2 (1:1-56) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

Timeline for d1vq711:

• d1vq711 first appeared in SCOP 1.73
  
• d1vq711 appears in SCOPe 2.07