SCOPe 2.05: Domain d1vfqa_: 1vfq A:

Lineage for d1vfqa_ (1vfq A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein automated matches [190045] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries)

8. Domain d1vfqa_: 1vfq A: [120054]
   automated match to d1wnja_

Details for d1vfqa_

PDB Entry: 1vfq, 1.9 Å

PDB Description: The Crystal Structure of Human Coactosin-like Protein at 1.9 A Resolution

PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1vfqa_:

Sequence; same for both SEQRES and ATOM records:

>d1vfqa_ d.109.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smatkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlf
afvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrke
leedfikselkk

Timeline for d1vfqa_:

• d1vfqa_ first appeared in SCOP 1.73, called d1vfqa1
  
• d1vfqa_ appears in SCOPe 2.04
  
• d1vfqa_ is called d1vfqa2 in SCOPe 2.06
  
• d1vfqa_ appears in the current release, SCOPe 2.08, called d1vfqa2