SCOPe 2.08: Domain d1vfqa2: 1vfq A:1-131

Lineage for d1vfqa2 (1vfq A:1-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein automated matches [190045] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries)

8. Domain d1vfqa2: 1vfq A:1-131 [120054]
   Other proteins in same PDB: d1vfqa3
   automated match to d1wnja_

Details for d1vfqa2

PDB Entry: 1vfq, 1.9 Å

PDB Description: The Crystal Structure of Human Coactosin-like Protein at 1.9 A Resolution

PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1vfqa2:

Sequence; same for both SEQRES and ATOM records:

>d1vfqa2 d.109.1.2 (A:1-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfa
fvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkel
eedfikselkk

Timeline for d1vfqa2:

• d1vfqa2 first appeared in SCOP 1.73, called d1vfqa1
  
• d1vfqa2 appears in SCOPe 2.07