Lineage for d1vfqa2 (1vfq A:1-131)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210305Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2210358Protein automated matches [190045] (5 species)
    not a true protein
  7. 2210368Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries)
  8. 2210371Domain d1vfqa2: 1vfq A:1-131 [120054]
    Other proteins in same PDB: d1vfqa3
    automated match to d1wnja_

Details for d1vfqa2

PDB Entry: 1vfq (more details), 1.9 Å

PDB Description: The Crystal Structure of Human Coactosin-like Protein at 1.9 A Resolution
PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1vfqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfqa2 d.109.1.2 (A:1-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfa
fvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkel
eedfikselkk

SCOPe Domain Coordinates for d1vfqa2:

Click to download the PDB-style file with coordinates for d1vfqa2.
(The format of our PDB-style files is described here.)

Timeline for d1vfqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vfqa3