SCOPe 2.08: Domain d1vbha2: 1vbh A:383-517

Lineage for d1vbha2 (1vbh A:383-517)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (3 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)

6. Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)

7. Species Maize (Zea mays) [TaxId:4577] [141971] (2 PDB entries)
   Uniprot P11155 454-588

8. Domain d1vbha2: 1vbh A:383-517 [119955]
   Other proteins in same PDB: d1vbha1, d1vbha3
   automated match to d1vbga2
   complexed with mg, pep, so4

Details for d1vbha2

PDB Entry: 1vbh, 2.3 Å

PDB Description: pyruvate phosphate dikinase with bound mg-pep from maize

PDB Compounds: (A:) pyruvate,orthophosphate dikinase

SCOPe Domain Sequences for d1vbha2:

Sequence, based on SEQRES records:

>d1vbha2 c.8.1.1 (A:383-517) Pyruvate phosphate dikinase, central domain {Maize (Zea mays) [TaxId: 4577]}
qfenpsaykdqviatglpaspgaavgqvvftaedaeawhsqgkaailvraetspedvggm
haavgilterggmtshaavvargwgkccvsgcsgirvndaeklvtigghvlregewlsln
gstgevilgkqplsp

Sequence, based on observed residues (ATOM records):

>d1vbha2 c.8.1.1 (A:383-517) Pyruvate phosphate dikinase, central domain {Maize (Zea mays) [TaxId: 4577]}
qfenpsaykdqviatglpaspgaavgqvvftaedaeawhsqgkaailvraetspedvggm
haavgiltemtshaavvargwgkccvsgcsgirvndaeklvtigghvlregewlslngst
gevilgkqplsp

Timeline for d1vbha2:

• d1vbha2 first appeared in SCOP 1.73
  
• d1vbha2 appears in SCOPe 2.07