Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein) N-terminal domain is alpha+beta |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [69403] (6 PDB entries) |
Domain d1uw9v1: 1uw9 V:150-475 [119731] Other proteins in same PDB: d1uw9a2, d1uw9b2, d1uw9c1, d1uw9e2, d1uw9f1, d1uw9h2, d1uw9i1, d1uw9j1, d1uw9k2, d1uw9m1, d1uw9o2, d1uw9p1, d1uw9r2, d1uw9t1, d1uw9v2, d1uw9w1 automatically matched to d1gk8a1 complexed with cap, edo, mg; mutant |
PDB Entry: 1uw9 (more details), 2.05 Å
SCOP Domain Sequences for d1uw9v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw9v1 c.1.14.1 (V:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq pfmrwrdrflfvteaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy ltggftantslaiycrdnglflhihramhavidrqrnhgihfrvlakalrmsggdhlhsg tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac kwspelaaacevwkeikfefdtidkl
Timeline for d1uw9v1: