Lineage for d1uw9v1 (1uw9 V:150-475)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685056Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 685057Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 685058Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 685083Species Chlamydomonas reinhardtii [TaxId:3055] [69403] (6 PDB entries)
  8. 685127Domain d1uw9v1: 1uw9 V:150-475 [119731]
    Other proteins in same PDB: d1uw9a2, d1uw9b2, d1uw9c1, d1uw9e2, d1uw9f1, d1uw9h2, d1uw9i1, d1uw9j1, d1uw9k2, d1uw9m1, d1uw9o2, d1uw9p1, d1uw9r2, d1uw9t1, d1uw9v2, d1uw9w1
    automatically matched to d1gk8a1
    complexed with cap, edo, mg; mutant

Details for d1uw9v1

PDB Entry: 1uw9 (more details), 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant
PDB Compounds: (V:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1uw9v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw9v1 c.1.14.1 (V:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvteaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglflhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOP Domain Coordinates for d1uw9v1:

Click to download the PDB-style file with coordinates for d1uw9v1.
(The format of our PDB-style files is described here.)

Timeline for d1uw9v1: