![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (6 PDB entries) |
![]() | Domain d1uw9b2: 1uw9 B:11-149 [119713] Other proteins in same PDB: d1uw9a1, d1uw9b1, d1uw9c1, d1uw9e1, d1uw9f1, d1uw9h1, d1uw9i1, d1uw9j1, d1uw9k1, d1uw9m1, d1uw9o1, d1uw9p1, d1uw9r1, d1uw9t1, d1uw9v1, d1uw9w1 automatically matched to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 1uw9 (more details), 2.05 Å
SCOP Domain Sequences for d1uw9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw9b2 d.58.9.1 (B:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal ralrledlrippayvktfv
Timeline for d1uw9b2: