SCOP 1.73: Domain d1uw9c1: 1uw9 C:2-126

Lineage for d1uw9c1 (1uw9 C:2-126)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (4 PDB entries)

8. Domain d1uw9c1: 1uw9 C:2-126 [119714]
   Other proteins in same PDB: d1uw9a1, d1uw9a2, d1uw9b1, d1uw9b2, d1uw9e1, d1uw9e2, d1uw9h1, d1uw9h2, d1uw9k1, d1uw9k2, d1uw9o1, d1uw9o2, d1uw9r1, d1uw9r2, d1uw9v1, d1uw9v2
   automatically matched to d1gk8i_
   complexed with cap, edo, mg; mutant

Details for d1uw9c1

PDB Entry: 1uw9, 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant

PDB Compounds: (C:) ribulose bisphosphate carboxylase small chain 1

SCOP Domain Sequences for d1uw9c1:

Sequence; same for both SEQRES and ATOM records:

>d1uw9c1 d.73.1.1 (C:2-126) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrp

Timeline for d1uw9c1:

• d1uw9c1 is new in SCOP 1.73
  
• d1uw9c1 appears in SCOP 1.75
  
• d1uw9c1 appears in the current release, SCOPe 2.08, called d1uw9c_