| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) ![]() |
| Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
| Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140638] (1 PDB entry) Uniprot P39748 218-357 |
| Domain d1ul1z1: 1ul1 Z:218-356 [119694] Other proteins in same PDB: d1ul1a1, d1ul1a2, d1ul1b1, d1ul1b2, d1ul1c1, d1ul1c2, d1ul1x2, d1ul1y2, d1ul1z2 automated match to d1ul1x1 protein/DNA complex; complexed with mg |
PDB Entry: 1ul1 (more details), 2.9 Å
SCOPe Domain Sequences for d1ul1z1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ul1z1 a.60.7.1 (Z:218-356) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
lnqeqfvdlcillgsdycesirgigpkravdliqkhksieeivrrldpnkypvpenwlhk
eahqlflepevldpesvelkwsepneeelikfmcgekqfseerirsgvkrlsksrqgstq
grlddffkvtgslssakrk
Timeline for d1ul1z1: