SCOPe 2.06: Domain d1u9va_: 1u9v A:

Lineage for d1u9va_ (1u9v A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (51 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d1u9va_: 1u9v A: [119652]
   automated match to d1tu6a_
   complexed with ihe

Details for d1u9va_

PDB Entry: 1u9v, 2.2 Å

PDB Description: crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor nvp-abe854

PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d1u9va_:

Sequence; same for both SEQRES and ATOM records:

>d1u9va_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1u9va_:

• d1u9va_ first appeared in SCOP 1.73, called d1u9va1
  
• d1u9va_ appears in SCOPe 2.05
  
• d1u9va_ appears in SCOPe 2.07
  
• d1u9va_ appears in the current release, SCOPe 2.08