![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) ![]() |
![]() | Family a.211.1.5: Ppx associated domain [140773] (1 protein) this domain is C-terminal to Ppx domain in some Exopolyphosphatases |
![]() | Protein Exopolyphosphatase Ppx C-terminal domain [140774] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [140775] (2 PDB entries) Uniprot P0AFL6 312-508 |
![]() | Domain d1u6za1: 1u6z A:313-509 [119608] Other proteins in same PDB: d1u6za2, d1u6za3, d1u6zb2, d1u6zb3 complexed with so4 |
PDB Entry: 1u6z (more details), 1.9 Å
SCOPe Domain Sequences for d1u6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6za1 a.211.1.5 (A:313-509) Exopolyphosphatase Ppx C-terminal domain {Escherichia coli [TaxId: 562]} dvrsrtasslanqyhidseqarrvldttmqmyeqwreqqpklahpqleallrwaamlhev glninhsglhrhsayilqnsdlpgfnqeqqlmmatlvryhrkaiklddlprftlfkkkqf lpliqllrlgvllnnqrqatttpptltlitddshwtlrfphdwfsqnalvlldlekeqey wegvagwrlkieeestp
Timeline for d1u6za1: