Lineage for d1u6za1 (1u6z A:313-509)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015241Family a.211.1.5: Ppx associated domain [140773] (1 protein)
    this domain is C-terminal to Ppx domain in some Exopolyphosphatases
  6. 2015242Protein Exopolyphosphatase Ppx C-terminal domain [140774] (1 species)
  7. 2015243Species Escherichia coli [TaxId:562] [140775] (2 PDB entries)
    Uniprot P0AFL6 312-508
  8. 2015244Domain d1u6za1: 1u6z A:313-509 [119608]
    Other proteins in same PDB: d1u6za2, d1u6za3, d1u6zb2, d1u6zb3
    complexed with so4

Details for d1u6za1

PDB Entry: 1u6z (more details), 1.9 Å

PDB Description: Structure of an E. coli Exopolyphosphatase: Insight into the processive hydrolysis of polyphosphate and its regulation
PDB Compounds: (A:) exopolyphosphatase

SCOPe Domain Sequences for d1u6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6za1 a.211.1.5 (A:313-509) Exopolyphosphatase Ppx C-terminal domain {Escherichia coli [TaxId: 562]}
dvrsrtasslanqyhidseqarrvldttmqmyeqwreqqpklahpqleallrwaamlhev
glninhsglhrhsayilqnsdlpgfnqeqqlmmatlvryhrkaiklddlprftlfkkkqf
lpliqllrlgvllnnqrqatttpptltlitddshwtlrfphdwfsqnalvlldlekeqey
wegvagwrlkieeestp

SCOPe Domain Coordinates for d1u6za1:

Click to download the PDB-style file with coordinates for d1u6za1.
(The format of our PDB-style files is described here.)

Timeline for d1u6za1: