SCOPe 2.08: Domain d1u6za1: 1u6z A:313-509

Lineage for d1u6za1 (1u6z A:313-509)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.5: Ppx associated domain [140773] (1 protein)
   this domain is C-terminal to Ppx domain in some Exopolyphosphatases

6. Protein Exopolyphosphatase Ppx C-terminal domain [140774] (1 species)

7. Species Escherichia coli [TaxId:562] [140775] (2 PDB entries)
   Uniprot P0AFL6 312-508

8. Domain d1u6za1: 1u6z A:313-509 [119608]
   Other proteins in same PDB: d1u6za2, d1u6za3, d1u6zb2, d1u6zb3
   complexed with so4

Details for d1u6za1

PDB Entry: 1u6z, 1.9 Å

PDB Description: Structure of an E. coli Exopolyphosphatase: Insight into the processive hydrolysis of polyphosphate and its regulation

PDB Compounds: (A:) exopolyphosphatase

SCOPe Domain Sequences for d1u6za1:

Sequence; same for both SEQRES and ATOM records:

>d1u6za1 a.211.1.5 (A:313-509) Exopolyphosphatase Ppx C-terminal domain {Escherichia coli [TaxId: 562]}
dvrsrtasslanqyhidseqarrvldttmqmyeqwreqqpklahpqleallrwaamlhev
glninhsglhrhsayilqnsdlpgfnqeqqlmmatlvryhrkaiklddlprftlfkkkqf
lpliqllrlgvllnnqrqatttpptltlitddshwtlrfphdwfsqnalvlldlekeqey
wegvagwrlkieeestp

Timeline for d1u6za1:

• d1u6za1 first appeared in SCOP 1.73
  
• d1u6za1 appears in SCOPe 2.07