![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein) Pfam PF02541 |
![]() | Protein Exopolyphosphatase Ppx [110631] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [142466] (2 PDB entries) Uniprot P0AFL6 11-134! Uniprot P0AFL6 135-311 |
![]() | Domain d1u6za3: 1u6z A:136-312 [119610] Other proteins in same PDB: d1u6za1, d1u6zb1 complexed with so4 |
PDB Entry: 1u6z (more details), 1.9 Å
SCOPe Domain Sequences for d1u6za3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} kgrklvidigggstelvigenfepilvesrrmgcvsfaqlyfpggvinkenfqrarmaaa qkletltwqfriqgwnvamgasgtikaahevlmemgekdgiitperleklvkevlrhrnf aslslpglseerktvfvpglailcgvfdalairelrlsdgalregvlyemegrfrhq
Timeline for d1u6za3: