![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
![]() | Protein Creatine kinase, C-terminal domain [55936] (7 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55940] (2 PDB entries) |
![]() | Domain d1u6rb2: 1u6r B:102-380 [119603] Other proteins in same PDB: d1u6ra1, d1u6rb1 automated match to d1g0wa2 complexed with adp, iom, mg, no3; mutant |
PDB Entry: 1u6r (more details), 1.65 Å
SCOPe Domain Sequences for d1u6rb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6rb2 d.128.1.2 (B:102-380) Creatine kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tdkhktdlnhenlkggddldphyvlssrvrtgksikgytlpphcsrgerraveklsveal nsltgefkgkyyplksmteqeqqqliddhflfdkpvsplllasgmardwpdargiwhndn ksflvwvneedhlrvismekggnmkevfrrfcvglqkieeifkkaghpfmwnehlgyvlt cpsnlgtglrggvhvklahlskhpkfeeiltrlrlqkrgtggvdtaavgsvfdisnadrl gsseveqvqlvvdgvklmvemekklekgqsiddmipaqk
Timeline for d1u6rb2: