Lineage for d1u6rb2 (1u6r B:102-380)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538454Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2538482Protein Creatine kinase, C-terminal domain [55936] (7 species)
  7. 2538514Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55940] (2 PDB entries)
  8. 2538516Domain d1u6rb2: 1u6r B:102-380 [119603]
    Other proteins in same PDB: d1u6ra1, d1u6rb1
    automated match to d1g0wa2
    complexed with adp, iom, mg, no3; mutant

Details for d1u6rb2

PDB Entry: 1u6r (more details), 1.65 Å

PDB Description: transition state analog complex of muscle creatine kinase (r134k) mutant
PDB Compounds: (B:) Creatine kinase, M chain

SCOPe Domain Sequences for d1u6rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6rb2 d.128.1.2 (B:102-380) Creatine kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdkhktdlnhenlkggddldphyvlssrvrtgksikgytlpphcsrgerraveklsveal
nsltgefkgkyyplksmteqeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ksflvwvneedhlrvismekggnmkevfrrfcvglqkieeifkkaghpfmwnehlgyvlt
cpsnlgtglrggvhvklahlskhpkfeeiltrlrlqkrgtggvdtaavgsvfdisnadrl
gsseveqvqlvvdgvklmvemekklekgqsiddmipaqk

SCOPe Domain Coordinates for d1u6rb2:

Click to download the PDB-style file with coordinates for d1u6rb2.
(The format of our PDB-style files is described here.)

Timeline for d1u6rb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6rb1