SCOPe 2.06: Domain d1u6al1: 1u6a L:1-107

Lineage for d1u6al1 (1u6a L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d1u6al1: 1u6a L:1-107 [119566]
   Other proteins in same PDB: d1u6ah1, d1u6ah2, d1u6al2
   automated match to d3hi1a1

Details for d1u6al1

PDB Entry: 1u6a, 2.81 Å

PDB Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105

PDB Compounds: (L:) f105 light chain

SCOPe Domain Sequences for d1u6al1:

Sequence; same for both SEQRES and ATOM records:

>d1u6al1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslsageratlscrasqsvssrylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrvepedfavyycqqydnsvctfgqgtkleik

Timeline for d1u6al1:

• d1u6al1 first appeared in SCOP 1.73
  
• d1u6al1 appears in SCOPe 2.05
  
• d1u6al1 appears in SCOPe 2.07
  
• d1u6al1 appears in the current release, SCOPe 2.08