Lineage for d1u6al1 (1u6a L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756790Domain d1u6al1: 1u6a L:1-107 [119566]
    Other proteins in same PDB: d1u6ah1, d1u6ah2, d1u6al2
    automated match to d3hi1a1

Details for d1u6al1

PDB Entry: 1u6a (more details), 2.81 Å

PDB Description: Crystal Structure of the Broadly Neutralizing Anti-HIV Fab F105
PDB Compounds: (L:) f105 light chain

SCOPe Domain Sequences for d1u6al1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6al1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslsageratlscrasqsvssrylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrvepedfavyycqqydnsvctfgqgtkleik

SCOPe Domain Coordinates for d1u6al1:

Click to download the PDB-style file with coordinates for d1u6al1.
(The format of our PDB-style files is described here.)

Timeline for d1u6al1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u6al2