SCOPe 2.08: Domain d1u3hh2: 1u3h H:1-92

Lineage for d1u3hh2 (1u3h H:1-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89860] (2 PDB entries)

8. Domain d1u3hh2: 1u3h H:1-92 [119517]
   Other proteins in same PDB: d1u3ha1, d1u3hb1, d1u3hc1, d1u3hc2, d1u3hc3, d1u3hd1, d1u3he_, d1u3hf_, d1u3hg1, d1u3hg2, d1u3hg3, d1u3hh1
   automated match to d1k2db2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1u3hh2

PDB Entry: 1u3h, 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a

PDB Compounds: (H:) H-2 class II histocompatibility antigen, A-U beta chain

SCOPe Domain Sequences for d1u3hh2:

Sequence; same for both SEQRES and ATOM records:

>d1u3hh2 d.19.1.1 (H:1-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
gdserhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaey
ynkqylertraeldtvcrynyeetevptslr

Timeline for d1u3hh2:

• d1u3hh2 first appeared in SCOP 1.73
  
• d1u3hh2 appears in SCOPe 2.07