| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (6 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [254907] (1 PDB entry) |
| Domain d1u35f_: 1u35 F: [119498] Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1 automated match to d1s32f_ protein/DNA complex |
PDB Entry: 1u35 (more details), 3 Å
SCOPe Domain Sequences for d1u35f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u35f_ a.22.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg
Timeline for d1u35f_: