SCOPe 2.02: Domain d1u35b1: 1u35 B:24-102

Lineage for d1u35b1 (1u35 B:24-102)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47128] (2 PDB entries)

8. Domain d1u35b1: 1u35 B:24-102 [119494]
   Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1, d1u35g1, d1u35h1
   automatically matched to d1p3ob_
   protein/DNA complex

Details for d1u35b1

PDB Entry: 1u35, 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a

PDB Compounds: (B:) Hist1h4i protein

SCOPe Domain Sequences for d1u35b1:

Sequence; same for both SEQRES and ATOM records:

>d1u35b1 a.22.1.1 (B:24-102) Histone H4 {Mouse (Mus musculus) [TaxId: 10090]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

Timeline for d1u35b1:

• d1u35b1 first appeared in SCOP 1.73
  
• d1u35b1 appears in SCOPe 2.01
  
• d1u35b1 appears in SCOPe 2.03
  
• d1u35b1 appears in the current release, SCOPe 2.08, called d1u35b_