![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47128] (2 PDB entries) |
![]() | Domain d1u35b1: 1u35 B:24-102 [119494] Other proteins in same PDB: d1u35a1, d1u35c1, d1u35d1, d1u35e1, d1u35g1, d1u35h1 automatically matched to d1p3ob_ protein/DNA complex |
PDB Entry: 1u35 (more details), 3 Å
SCOPe Domain Sequences for d1u35b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u35b1 a.22.1.1 (B:24-102) Histone H4 {Mouse (Mus musculus) [TaxId: 10090]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d1u35b1: