Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
Protein Sucrose-phosphatase Slr0953 [142163] (1 species) |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [142164] (9 PDB entries) Uniprot P74325 1-244 |
Domain d1u2ta_: 1u2t A: [119486] automated match to d1s2oa1 complexed with sup |
PDB Entry: 1u2t (more details), 2.9 Å
SCOPe Domain Sequences for d1u2ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2ta_ c.108.1.10 (A:) Sucrose-phosphatase Slr0953 {Synechocystis sp. PCC 6803 [TaxId: 1148]} mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf dfls
Timeline for d1u2ta_: