SCOP 1.73: Domain d1u2ta1: 1u2t A:1-244

Lineage for d1u2ta1 (1u2t A:1-244)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Sucrose-phosphatase Slr0953 [142163] (1 species)

7. Species Synechocystis sp. pcc 6803 [TaxId:1148] [142164] (9 PDB entries)

8. Domain d1u2ta1: 1u2t A:1-244 [119486]
   automatically matched to 1S2O A:1-244
   complexed with sup

Details for d1u2ta1

PDB Entry: 1u2t, 2.9 Å

PDB Description: x-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 in complex with sucrose6p

PDB Compounds: (A:) sucrose-phosphatase (SPP)

SCOP Domain Sequences for d1u2ta1:

Sequence; same for both SEQRES and ATOM records:

>d1u2ta1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]}
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls

Timeline for d1u2ta1:

• d1u2ta1 is new in SCOP 1.73
  
• d1u2ta1 appears in SCOP 1.75
  
• d1u2ta1 appears in the current release, SCOPe 2.08, called d1u2ta_