SCOP 1.73: Domain d1u20b1: 1u20 B:18-209

Lineage for d1u20b1 (1u20 B:18-209)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.1: MutT-like [55812] (16 proteins)

6. Protein U8 snorna-binding protein x29 [143764] (1 species)
   nuclear decapping enzyme

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [143765] (6 PDB entries)

8. Domain d1u20b1: 1u20 B:18-209 [119464]
   automatically matched to 1U20 A:14-209
   complexed with gol

Details for d1u20b1

PDB Entry: 1u20, 2.1 Å

PDB Description: Crystal Structure of Xenopus laevis nudix hydrolase nuclear SnoRNA decapping Protein X29

PDB Compounds: (B:) U8 snoRNA-binding protein X29

SCOP Domain Sequences for d1u20b1:

Sequence; same for both SEQRES and ATOM records:

>d1u20b1 d.113.1.1 (B:18-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
dqiqevlkashr

Timeline for d1u20b1:

• d1u20b1 is new in SCOP 1.73
  
• d1u20b1 appears in SCOP 1.75
  
• d1u20b1 appears in the current release, SCOPe 2.08, called d1u20b_