PDB entry 1u20

View 1u20 on RCSB PDB site
Description: Crystal Structure of Xenopus laevis nudix hydrolase nuclear SnoRNA decapping Protein X29
Class: hydrolase
Keywords: modified Nudix hydrolase fold
Deposited on 2004-07-16, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U8 snoRNA-binding protein X29
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u20a1
  • Chain 'B':
    Compound: U8 snoRNA-binding protein X29
    Species: Xenopus laevis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u20b1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u20A (A:)
    maesrspdrgakedkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllm
    mmrfdgrlgfpggfvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkc
    vthfyikelkleeierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfign
    sksqllyalrslkllredqiqevlkashrlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u20A (A:)
    dkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpgg
    fvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelklee
    ierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslk
    llredqiqevlkashr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u20B (B:)
    maesrspdrgakedkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllm
    mmrfdgrlgfpggfvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkc
    vthfyikelkleeierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfign
    sksqllyalrslkllredqiqevlkashrlqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u20B (B:)
    prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
    rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
    eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
    dqiqevlkashr