Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (7 families) |
Family d.113.1.1: MutT-like [55812] (16 proteins) |
Protein U8 snorna-binding protein x29 [143764] (1 species) nuclear decapping enzyme |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [143765] (6 PDB entries) |
Domain d1u20a1: 1u20 A:14-209 [119463] complexed with gol |
PDB Entry: 1u20 (more details), 2.1 Å
SCOP Domain Sequences for d1u20a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpgg fvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelklee ierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslk llredqiqevlkashr
Timeline for d1u20a1: