![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein U8 snorna-binding protein x29 [143764] (1 species) nuclear decapping enzyme |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [143765] (1 PDB entry) Uniprot Q6TEC1 14-209 |
![]() | Domain d1u20a1: 1u20 A:14-209 [119463] Other proteins in same PDB: d1u20b_ complexed with gol |
PDB Entry: 1u20 (more details), 2.1 Å
SCOPe Domain Sequences for d1u20a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpgg fvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelklee ierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslk llredqiqevlkashr
Timeline for d1u20a1: