SCOPe 2.08: Domain d1u20a1: 1u20 A:14-209

Lineage for d1u20a1 (1u20 A:14-209)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein U8 snorna-binding protein x29 [143764] (1 species)
   nuclear decapping enzyme

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [143765] (1 PDB entry)
   Uniprot Q6TEC1 14-209

8. Domain d1u20a1: 1u20 A:14-209 [119463]
   Other proteins in same PDB: d1u20b_
   complexed with gol

Details for d1u20a1

PDB Entry: 1u20, 2.1 Å

PDB Description: Crystal Structure of Xenopus laevis nudix hydrolase nuclear SnoRNA decapping Protein X29

PDB Compounds: (A:) U8 snoRNA-binding protein X29

SCOPe Domain Sequences for d1u20a1:

Sequence; same for both SEQRES and ATOM records:

>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpgg
fvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelklee
ierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslk
llredqiqevlkashr

Timeline for d1u20a1:

• d1u20a1 first appeared in SCOP 1.73
  
• d1u20a1 appears in SCOPe 2.07