Lineage for d1u20a1 (1u20 A:14-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971603Protein U8 snorna-binding protein x29 [143764] (1 species)
    nuclear decapping enzyme
  7. 2971604Species African clawed frog (Xenopus laevis) [TaxId:8355] [143765] (1 PDB entry)
    Uniprot Q6TEC1 14-209
  8. 2971605Domain d1u20a1: 1u20 A:14-209 [119463]
    Other proteins in same PDB: d1u20b_
    complexed with gol

Details for d1u20a1

PDB Entry: 1u20 (more details), 2.1 Å

PDB Description: Crystal Structure of Xenopus laevis nudix hydrolase nuclear SnoRNA decapping Protein X29
PDB Compounds: (A:) U8 snoRNA-binding protein X29

SCOPe Domain Sequences for d1u20a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dkprprnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpgg
fvdtrdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelklee
ierieaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslk
llredqiqevlkashr

SCOPe Domain Coordinates for d1u20a1:

Click to download the PDB-style file with coordinates for d1u20a1.
(The format of our PDB-style files is described here.)

Timeline for d1u20a1: