SCOPe 2.02: Domain d1u1ee_: 1u1e E:

Lineage for d1u1ee_ (1u1e E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (2 species)

7. Species Escherichia coli [TaxId:562] [53177] (15 PDB entries)

8. Domain d1u1ee_: 1u1e E: [119437]
   automated match to d1k3fa_
   complexed with 182, k, po4

Details for d1u1ee_

PDB Entry: 1u1e, 2 Å

PDB Description: structure of e. coli uridine phosphorylase complexed to 5(phenylseleno)acyclouridine (psau)

PDB Compounds: (E:) Uridine phosphorylase

SCOPe Domain Sequences for d1u1ee_:

Sequence; same for both SEQRES and ATOM records:

>d1u1ee_ c.56.2.1 (E:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

Timeline for d1u1ee_:

• d1u1ee_ first appeared in SCOP 1.73, called d1u1ee1
  
• d1u1ee_ appears in SCOPe 2.01
  
• d1u1ee_ appears in SCOPe 2.03
  
• d1u1ee_ appears in the current release, SCOPe 2.08