Lineage for d1txqb1 (1txq B:192-255)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509301Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 1509302Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 1509303Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 1509304Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)
  7. 1509305Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 1509310Domain d1txqb1: 1txq B:192-255 [119389]
    Other proteins in same PDB: d1txqa1

Details for d1txqb1

PDB Entry: 1txq (more details), 1.8 Å

PDB Description: Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d1txqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txqb1 a.245.1.1 (B:192-255) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatde
gfvi

SCOPe Domain Coordinates for d1txqb1:

Click to download the PDB-style file with coordinates for d1txqb1.
(The format of our PDB-style files is described here.)

Timeline for d1txqb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1txqa1