Class a: All alpha proteins [46456] (286 folds) |
Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily) dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices |
Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) |
Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins) Pfam PF03271 |
Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries) Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254 |
Domain d1txqb1: 1txq B:192-255 [119389] Other proteins in same PDB: d1txqa1 |
PDB Entry: 1txq (more details), 1.8 Å
SCOPe Domain Sequences for d1txqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txqb1 a.245.1.1 (B:192-255) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]} eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatde gfvi
Timeline for d1txqb1: