Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (35 species) not a true protein |
Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (1 PDB entry) |
Domain d1tp9c_: 1tp9 C: [119308] Other proteins in same PDB: d1tp9a1 automated match to d1h4oa_ complexed with so4 |
PDB Entry: 1tp9 (more details), 1.62 Å
SCOPe Domain Sequences for d1tp9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tp9c_ c.47.1.0 (C:) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]} mapiavgdvlpdgklayfdeqdqlqevsvhslvagkkvilfgvpgaftptcslkhvpgfi ekagelkskgvteilcisvndpfvmkawaksypenkhvkfladgsatythalgleldlqe kglgtrsrrfallvddlkvkaaniegggeftvssaedilkdl
Timeline for d1tp9c_: