SCOPe 2.01: Domain d1tp9c_: 1tp9 C:

Lineage for d1tp9c_ (1tp9 C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (1 PDB entry)

8. Domain d1tp9c_: 1tp9 C: [119308]
   Other proteins in same PDB: d1tp9a1
   automated match to d1h4oa_
   complexed with so4

Details for d1tp9c_

PDB Entry: 1tp9, 1.62 Å

PDB Description: PRX D (type II) from Populus tremula

PDB Compounds: (C:) peroxiredoxin

SCOPe Domain Sequences for d1tp9c_:

Sequence; same for both SEQRES and ATOM records:

>d1tp9c_ c.47.1.0 (C:) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
mapiavgdvlpdgklayfdeqdqlqevsvhslvagkkvilfgvpgaftptcslkhvpgfi
ekagelkskgvteilcisvndpfvmkawaksypenkhvkfladgsatythalgleldlqe
kglgtrsrrfallvddlkvkaaniegggeftvssaedilkdl

Timeline for d1tp9c_:

• d1tp9c_ first appeared in SCOP 1.73, called d1tp9c1
  
• d1tp9c_ was called d1tp9c1 in SCOP 1.75
  
• d1tp9c_ appears in SCOPe 2.02
  
• d1tp9c_ appears in the current release, SCOPe 2.08