Lineage for d1tp9c_ (1tp9 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880525Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (13 PDB entries)
  8. 2880528Domain d1tp9c_: 1tp9 C: [119308]
    Other proteins in same PDB: d1tp9a1
    automated match to d1h4oa_
    complexed with so4

Details for d1tp9c_

PDB Entry: 1tp9 (more details), 1.62 Å

PDB Description: PRX D (type II) from Populus tremula
PDB Compounds: (C:) peroxiredoxin

SCOPe Domain Sequences for d1tp9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp9c_ c.47.1.0 (C:) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
mapiavgdvlpdgklayfdeqdqlqevsvhslvagkkvilfgvpgaftptcslkhvpgfi
ekagelkskgvteilcisvndpfvmkawaksypenkhvkfladgsatythalgleldlqe
kglgtrsrrfallvddlkvkaaniegggeftvssaedilkdl

SCOPe Domain Coordinates for d1tp9c_:

Click to download the PDB-style file with coordinates for d1tp9c_.
(The format of our PDB-style files is described here.)

Timeline for d1tp9c_: