SCOPe 2.06: Domain d1tkwa_: 1tkw A:

Lineage for d1tkwa_ (1tkw A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (16 species)

7. Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (16 PDB entries)

8. Domain d1tkwa_: 1tkw A: [119297]
   automated match to d4dpbx_
   complexed with cu, hec

Details for d1tkwa_

PDB Entry: 1tkw

PDB Description: the transient complex of poplar plastocyanin with turnip cytochrome f determined with paramagnetic nmr

PDB Compounds: (A:) plastocyanin a

SCOPe Domain Sequences for d1tkwa_:

Sequence; same for both SEQRES and ATOM records:

>d1tkwa_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

Timeline for d1tkwa_:

• d1tkwa_ first appeared in SCOP 1.73, called d1tkwa1
  
• d1tkwa_ appears in SCOPe 2.05
  
• d1tkwa_ appears in SCOPe 2.07
  
• d1tkwa_ appears in the current release, SCOPe 2.08