Lineage for d1tkwa1 (1tkw A:1-99)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660500Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 660737Protein Plastocyanin [49507] (14 species)
  7. 660775Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (10 PDB entries)
  8. 660786Domain d1tkwa1: 1tkw A:1-99 [119297]
    automatically matched to d1plc__
    complexed with cu, hec

Details for d1tkwa1

PDB Entry: 1tkw (more details)

PDB Description: The transient complex of poplar plastocyanin with turnip cytochrome f determined with paramagnetic NMR
PDB Compounds: (A:) plastocyanin a

SCOP Domain Sequences for d1tkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkwa1 b.6.1.1 (A:1-99) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

SCOP Domain Coordinates for d1tkwa1:

Click to download the PDB-style file with coordinates for d1tkwa1.
(The format of our PDB-style files is described here.)

Timeline for d1tkwa1: