Lineage for d1tjra1 (1tjr A:86-346)
- Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) Protein Trp synthase alpha-subunit [51388] (5 species) 
Species Maize (Zea mays) [TaxId:4577] [117361] (2 PDB entries) 
Domain d1tjra1: 1tjr A:86-346 [119292]
complexed with so4
Details for d1tjra1
PDB Entry: 1tjr (more details), 2.3 Å
PDB Description: Crystal structure of wild-type BX1 complexed with a sulfate ion
PDB Compounds: (A:) bx1SCOP Domain Sequences for d1tjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjra1 c.1.2.4 (A:86-346) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]}
srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyykpimsrslaemkeagvhg
livpdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgp
ranvnprvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaa
spkqglrrleeyargmknalp
SCOP Domain Coordinates for d1tjra1:
Click to download the PDB-style file with coordinates for d1tjra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tjra1:
- d1tjra1 is new in SCOP 1.73
- d1tjra1 appears in SCOP 1.75
- d1tjra1 appears in the current release, SCOPe 2.08
View in 3D
