PDB entry 1tjr

View 1tjr on RCSB PDB site
Description: Crystal structure of wild-type BX1 complexed with a sulfate ion
Class: lyase
Keywords: Indole Glycerol phosphate, tryptophan synthase, lyase
Deposited on 2004-06-07, released 2005-08-30
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.285
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bx1
    Species: Zea mays
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42390 (0-260)
      • modified residue (7)
      • modified residue (11)
      • modified residue (77)
      • modified residue (83)
      • modified residue (105)
      • modified residue (112)
      • modified residue (157)
      • modified residue (231)
      • modified residue (255)
    Domains in SCOP 1.73: d1tjra1
  • Chain 'B':
    Compound: bx1
    Species: Zea mays
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42390 (0-260)
      • modified residue (7)
      • modified residue (11)
      • modified residue (77)
      • modified residue (83)
      • modified residue (105)
      • modified residue (112)
      • modified residue (157)
      • modified residue (231)
      • modified residue (255)
    Domains in SCOP 1.73: d1tjrb1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tjrA (A:)
    srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
    gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyykpimsrslaemkeagvhg
    livpdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgp
    ranvnprvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaa
    spkqglrrleeyargmknalp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tjrB (B:)
    srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
    gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyykpimsrslaemkeagvhg
    livpdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgp
    ranvnprvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaa
    spkqglrrleeyargmknalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tjrB (B:)
    srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
    gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyymsrslaemkeagvhgliv
    pdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgpvnp
    rvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaaspkqgl
    rrleeyargmknalp