Lineage for d1tjrb1 (1tjr B:86-346)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681489Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 681519Protein Trp synthase alpha-subunit [51388] (5 species)
  7. 681538Species Maize (Zea mays) [TaxId:4577] [117361] (2 PDB entries)
  8. 681542Domain d1tjrb1: 1tjr B:86-346 [119293]
    automatically matched to 1TJR A:86-346
    complexed with so4

Details for d1tjrb1

PDB Entry: 1tjr (more details), 2.3 Å

PDB Description: Crystal structure of wild-type BX1 complexed with a sulfate ion
PDB Compounds: (B:) bx1

SCOP Domain Sequences for d1tjrb1:

Sequence, based on SEQRES records: (download)

>d1tjrb1 c.1.2.4 (B:86-346) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]}
srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyykpimsrslaemkeagvhg
livpdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgp
ranvnprvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaa
spkqglrrleeyargmknalp

Sequence, based on observed residues (ATOM records): (download)

>d1tjrb1 c.1.2.4 (B:86-346) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]}
srpvsdtmaalmakgktafipyitagdpdlattaealrlldgcgadvielgvpcsdpyid
gpiiqasvaralasgttmdavlemlrevtpelscpvvllsyymsrslaemkeagvhgliv
pdlpyvaahslwseaknnnlelvllttpaipedrmkeitkasegfvylvsvngvtgpvnp
rvesliqevkkvtnkpvavgfgiskpehvkqiaqwgadgviigsamvrqlgeaaspkqgl
rrleeyargmknalp

SCOP Domain Coordinates for d1tjrb1:

Click to download the PDB-style file with coordinates for d1tjrb1.
(The format of our PDB-style files is described here.)

Timeline for d1tjrb1: