![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.38: Sm-like fold [50181] (3 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
![]() | Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [141290] (1 PDB entry) SnRNP-2 |
![]() | Domain d1th7a1: 1th7 A:3-78 [119264] |
PDB Entry: 1th7 (more details), 1.68 Å
SCOP Domain Sequences for d1th7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} mnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgkkl gtivirgdnvilispl
Timeline for d1th7a1: