Lineage for d1th7k1 (1th7 K:3-78)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666911Fold b.38: Sm-like fold [50181] (3 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 666912Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) (S)
  5. 666913Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 666914Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 667068Species Sulfolobus solfataricus [TaxId:2287] [141290] (1 PDB entry)
    SnRNP-2
  8. 667079Domain d1th7k1: 1th7 K:3-78 [119274]
    automatically matched to 1TH7 A:3-78

Details for d1th7k1

PDB Entry: 1th7 (more details), 1.68 Å

PDB Description: Crystal Structure of an Archaeal Sm Protein from Sulfolobus solfataricus
PDB Compounds: (K:) Small nuclear riboprotein protein

SCOP Domain Sequences for d1th7k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1th7k1 b.38.1.1 (K:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]}
mnflaetahkvlaeslnnlvlvklkgnkevrgmlrsydqhmnlvlsdseeiqsdgsgkkl
gtivirgdnvilispl

SCOP Domain Coordinates for d1th7k1:

Click to download the PDB-style file with coordinates for d1th7k1.
(The format of our PDB-style files is described here.)

Timeline for d1th7k1: