SCOPe 2.07: Domain d1tgyb_: 1tgy B:

Lineage for d1tgyb_ (1tgy B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (6 species)

7. Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)

8. Domain d1tgyb_: 1tgy B: [119250]
   automated match to d1k3fa_
   complexed with k, r1p, ura

Details for d1tgyb_

PDB Entry: 1tgy, 2.2 Å

PDB Description: structure of e. coli uridine phosphorylase complexed with uracil and ribose 1-phosphate

PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d1tgyb_:

Sequence; same for both SEQRES and ATOM records:

>d1tgyb_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Timeline for d1tgyb_:

• d1tgyb_ first appeared in SCOP 1.73, called d1tgyb1
  
• d1tgyb_ appears in SCOPe 2.06
  
• d1tgyb_ appears in the current release, SCOPe 2.08