SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1tgyb_ (1tgy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125805Protein Uridine phosphorylase [53176] (6 species)
  7. 2125806Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)
  8. 2125818Domain d1tgyb_: 1tgy B: [119250]
    automated match to d1k3fa_
    complexed with k, r1p, ura

Details for d1tgyb_

PDB Entry: 1tgy (more details), 2.2 Å

PDB Description: Structure of E. coli Uridine Phosphorylase complexed with uracil and ribose 1-phosphate
PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d1tgyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgyb_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOPe Domain Coordinates for d1tgyb_:

Click to download the PDB-style file with coordinates for d1tgyb_.
(The format of our PDB-style files is described here.)

Timeline for d1tgyb_: