SCOPe 2.07: Domain d1t8ia1: 1t8i A:636-712

Lineage for d1t8ia1 (1t8i A:636-712)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.8: Eukaryotic DNA topoisomerase I, dispensable insert domain [46596] (1 family)

5. Family a.2.8.1: Eukaryotic DNA topoisomerase I, dispensable insert domain [46597] (1 protein)

6. Protein Eukaryotic DNA topoisomerase I, dispensable insert domain [46598] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46599] (9 PDB entries)
   Uniprot P11387 203-767

8. Domain d1t8ia1: 1t8i A:636-712 [119172]
   Other proteins in same PDB: d1t8ia2, d1t8ia3
   automatically matched to d1rrja1
   protein/DNA complex; complexed with ehd

Details for d1t8ia1

PDB Entry: 1t8i, 3 Å

PDB Description: human dna topoisomerase i (70 kda) in complex with the poison camptothecin and covalent complex with a 22 base pair dna duplex

PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1t8ia1:

Sequence; same for both SEQRES and ATOM records:

>d1t8ia1 a.2.8.1 (A:636-712) Eukaryotic DNA topoisomerase I, dispensable insert domain {Human (Homo sapiens) [TaxId: 9606]}
ppktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkkvveskkkavqrle
eqlmklevqatdreenk

Timeline for d1t8ia1:

• d1t8ia1 first appeared in SCOP 1.73
  
• d1t8ia1 appears in SCOPe 2.06
  
• d1t8ia1 appears in the current release, SCOPe 2.08