SCOP 1.73: Domain d1t7jb1: 1t7j B:1-99

Lineage for d1t7jb1 (1t7j B:1-99)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries)

8. Domain d1t7jb1: 1t7j B:1-99 [119169]
   automatically matched to d1k6ca_
   complexed with 478, act; mutant

Details for d1t7jb1

PDB Entry: 1t7j, 2.2 Å

PDB Description: crystal structure of inhibitor amprenavir in complex with a multi-drug resistant variant of hiv-1 protease (l63p/v82t/i84v)

PDB Compounds: (B:) Pol polyprotein

SCOP Domain Sequences for d1t7jb1:

Sequence; same for both SEQRES and ATOM records:

>d1t7jb1 b.50.1.1 (B:1-99) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d1t7jb1:

• d1t7jb1 is new in SCOP 1.73
  
• d1t7jb1 appears in SCOP 1.75
  
• d1t7jb1 appears in the current release, SCOPe 2.08, called d1t7jb_