Lineage for d1t7ja1 (1t7j A:1-99)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 671909Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 672431Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 672432Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries)
  8. 672444Domain d1t7ja1: 1t7j A:1-99 [119168]
    automatically matched to d1k6ca_
    complexed with 478, act; mutant

Details for d1t7ja1

PDB Entry: 1t7j (more details), 2.2 Å

PDB Description: crystal structure of inhibitor amprenavir in complex with a multi-drug resistant variant of hiv-1 protease (l63p/v82t/i84v)
PDB Compounds: (A:) Pol polyprotein

SCOP Domain Sequences for d1t7ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7ja1 b.50.1.1 (A:1-99) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOP Domain Coordinates for d1t7ja1:

Click to download the PDB-style file with coordinates for d1t7ja1.
(The format of our PDB-style files is described here.)

Timeline for d1t7ja1: