Lineage for d1svga_ (1svg A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672116Protein cAMP-dependent PK, catalytic subunit [56116] (5 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 1672119Species Cow (Bos taurus) [TaxId:9913] [56118] (39 PDB entries)
    Uniprot P00517
  8. 1672130Domain d1svga_: 1svg A: [119061]
    automated match to d1cmke_
    complexed with i04

Details for d1svga_

PDB Entry: 1svg (more details), 2.02 Å

PDB Description: Crystal Structure of Protein Kinase A in Complex with Azepane Derivative 4
PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d1svga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svga_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
seqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhy
amkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemf
shlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfak
rvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyek
ivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrk
veapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d1svga_:

Click to download the PDB-style file with coordinates for d1svga_.
(The format of our PDB-style files is described here.)

Timeline for d1svga_: