SCOPe 2.08: Domain d1sqxb1: 1sqx B:17-235

Lineage for d1sqxb1 (1sqx B:17-235)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
   Uniprot P23004

8. Domain d1sqxb1: 1sqx B:17-235 [119037]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
   automated match to d1ppjb1
   complexed with fes, hec, sma, uq2

Details for d1sqxb1

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor

SCOPe Domain Sequences for d1sqxb1:

Sequence; same for both SEQRES and ATOM records:

>d1sqxb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
nhftsarmaliglgvshpvlkqvaeqflnirgglglsga

Timeline for d1sqxb1:

• d1sqxb1 first appeared in SCOP 1.73
  
• d1sqxb1 appears in SCOPe 2.07