SCOPe 2.08: Domain d1sqxi_: 1sqx I:

Lineage for d1sqxi_ (1sqx I:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families)
   not a true superfamily

5. Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
   beta-hairpin and a short alpha-helix bound to the core subunits

6. Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries)
   there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
   Uniprot P13272 1-57 ! Uniprot P13272

8. Domain d1sqxi_: 1sqx I: [119046]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxj_, d1sqxk_
   automated match to d1l0li_
   complexed with fes, hec, sma, uq2

Details for d1sqxi_

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (I:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1sqxi_:

Sequence; same for both SEQRES and ATOM records:

>d1sqxi_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

Timeline for d1sqxi_:

• d1sqxi_ first appeared in SCOP 1.73, called d1sqxi1
  
• d1sqxi_ appears in SCOPe 2.07