Lineage for d1sqxd1 (1sqx D:1-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691442Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2691443Protein Cytochrome bc1 domain [46677] (4 species)
  7. 2691462Species Cow (Bos taurus) [TaxId:9913] [46678] (19 PDB entries)
    Uniprot P00125
  8. 2691473Domain d1sqxd1: 1sqx D:1-195 [119041]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd2, d1sqxe1, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
    automated match to d1ppjd1
    complexed with fes, hec, sma, uq2

Details for d1sqxd1

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a
PDB Compounds: (D:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1sqxd1:

Click to download the PDB-style file with coordinates for d1sqxd1.
(The format of our PDB-style files is described here.)

Timeline for d1sqxd1: