Lineage for d1sc6d2 (1sc6 D:7-107,D:296-326)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465923Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2465924Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 2465948Protein Phosphoglycerate dehydrogenase [52293] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 2465949Species Escherichia coli [TaxId:562] [52294] (7 PDB entries)
  8. 2465953Domain d1sc6d2: 1sc6 D:7-107,D:296-326 [118942]
    Other proteins in same PDB: d1sc6a1, d1sc6a3, d1sc6b1, d1sc6b3, d1sc6c1, d1sc6c3, d1sc6d1, d1sc6d3
    automatically matched to d1psda2
    complexed with nad

Details for d1sc6d2

PDB Entry: 1sc6 (more details), 2.09 Å

PDB Description: crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+
PDB Compounds: (D:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d1sc6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc6d2 c.23.12.1 (D:7-107,D:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
edvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli
kysdngstlsavn

SCOPe Domain Coordinates for d1sc6d2:

Click to download the PDB-style file with coordinates for d1sc6d2.
(The format of our PDB-style files is described here.)

Timeline for d1sc6d2: